analytical methods raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-04-18. Anything still debated is marked as such rather than presented as settled.
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.
Development of AOD-9604 began in the 1990s as scientists sought to isolate metabolic effects of growth hormone without its growth-promoting actions. Early laboratory work focused on fat cells and animal models. Several human trials followed, examining changes in body composition and fat mass. Results have been mixed, and the peptide has not progressed to widespread clinical approval. Interest continues in research settings, particularly regarding its mechanism and potential metabolic targets.
Regulatory bodies have taken different approaches to AOD-9604. It is not approved as a prescription medicine by major agencies such as the U.S. Food and Drug Administration or the European Medicines Agency. In sport, the World Anti-Doping Agency prohibits peptide hormones, growth factors, and related substances, and AOD-9604 has been treated as a prohibited substance. These regulatory decisions reflect concerns about safety, efficacy, and potential misuse rather than proof of benefit.
Research on AOD-9604 also examines how the peptide is measured in biological samples. Analytical methods may include liquid chromatography coupled with mass spectrometry, immunoassays, or both. Detection can be challenging because the peptide is small and may be present at low concentrations. Published methods vary in sensitivity and specificity, so comparative interpretation requires attention to validation details. The presence of related hGH fragments can complicate identification in some matrices.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Peptide fragment | Corresponds to hGH residues 176-191 |
| Common synonyms | AOD9604, hGH 176-191 | Also written as AOD-9604 |
| Typical form | Lyophilized powder | Often supplied in sealed vials |
| Solubility | Water-soluble | Dissolves in aqueous buffers |
| Regulatory status | Not approved as drug | Banned in sport; varies by country |
AOD-9604 is a synthetic peptide whose sequence is modeled on the C-terminal region of human growth hormone. Published descriptions commonly place it as a modified fragment corresponding to hGH amino acids 176–191, with a tyrosine residue added or retained at the N-terminus to support detection and handling. It is not intact growth hormone and lacks the full receptor-binding architecture of the parent protein. The molecule was developed as a research candidate for metabolic studies rather than as a replacement for growth hormone therapy. Its identity is defined by its amino acid sequence rather than by any single commercial preparation.
AOD-9604 drew attention in the 1990s and 2000s as a potential anti-obesity agent. Early work explored both injectable and oral routes, which is unusual for a peptide of this size. Animal studies reported changes in fat metabolism without the growth-promoting or insulin-like effects associated with full-length growth hormone. Subsequent human trials produced mixed or modest results, and the compound did not obtain regulatory approval for weight management in major markets. It remains known mainly through research literature, sports anti-doping listings, and non-approved supplement advertising.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
in situ hybridization (ISH) A hybridization probe assay in which a labeled, single-stranded DNA or RNA molecule or nucleic acid analogue containing a sequence that is complementary to a particular DNA or RNA sequence is allowed to hybridize with its complement in situ, i.e. in its natural context, such as within cells or tissue sections (as opposed to within homogeneous samples extracted from cells or tissues, where cellular or histological structure has been lost in the process of obtaining the sample), in order to reveal the precise location of the complementary sequence within this context. The label may be a radioactive compound, fluorescent molecule, or hapten, permitting detection by a variety of visualization techniques. In situ hybridization is commonly used to identify the physical locations of specific DNA sequences such as genes and regulatory elements on chromosomes, which can provide insight into chromosomal structure and integrity; to determine the subcellular locations where various types of RNA accumulate and interact with other molecules; and to visualize the tissues and organs within an organism where specific genes are expressed at various developmental stages (by probing for the genes' RNA transcripts).
=== Carbohydrates === Carbohydrates make up about 50% of the dry weight of green coffee beans. The carbohydrate fraction of green coffee is dominated by polysaccharides, such as arabinogalactan, galactomannan, and cellulose, contributing to the tasteless flavor of green coffee. Mature brown to yellow coffee beans contain fewer residues of galactose and arabinose at the side chain of the polysaccharides, making the green coffee bean more resistant to physical breakdown and less soluble in water.
PREP C20: a column-based preparative fractionation instrument, capable to fractionate up to 20 grams of polymer. Soluble fraction CRYSTEX: instrument intended to measure the amorphous fraction of polypropylene and ethylene-propylene copolymers, for quality control laboratories for polypropylene manufacturing plants. CRYSTEX QC: fully automated instrument for amorphous phase determination in PP/EP manufacturing QC laboratories. CRYSTEX 42: high-throughput system for simultaneous measurement of the soluble fraction, ethylene content and intrinsic viscosity in a fully automated process for up to 42 samples. Infrared detectors
Sources: en.wikipedia.org
=== Suspended === Alprostadil topical (Alprox-TD; Befar; Cold Chain Vitaros; Femprox; RayVa; Room Temperature Vitaros; Virirec; Vitaros; Vytaros; WC-3036) – prostaglandin E1 (PGE1) agonist – female sexual dysfunction [67]
Distributed renewable energy (DRE) technologies, inclusive of solar-powered walk-in cold rooms, water pumps, TVs and cooking appliances, help small businesses generate jobs and income. They also strengthen agricultural value chains by improving irrigation, cold storage, and food processing and improve essential services in humanitarian settings such as lighting, medical cooling, clean cooking, and water access. CLASP programs unlock and increase financing for innovators and consumers, provide consumer protection and repairability services and advice, and guide government investment decisions. Climate Change Adaptation: Increasingly frequent and severe climate hazards are putting billions of people at risk. From fans and refrigerators that protect health and food, to agricultural and cold chain equipment that support farming and small businesses, efficient appliances help people maintain safety, livelihoods, and stability in the face of increasing climate shocks. CLASP’s research and programs help expand access to efficient appliances and support enabling policies.
=== Colour variations === Breeders have created different colour variations, principally varying proportions of red and blue colouring. The powder blue variant is almost entirely bright blue. The reddest variety (flame red) can be confused with the red variety of honey gouramis (Trichogaster chuna). One of the most common color morphs is the turquoise / neon blue, featuring stripes of dark red and bright blue.
Sources: en.wikipedia.org
AOD-9604 is a synthetic peptide fragment of human growth hormone, corresponding to amino acids 176-191. It is studied for potential effects on fat metabolism, but it is not approved as a drug in most countries. Its exact mechanism remains under investigation.
No, it is a small fragment of the full growth hormone protein. It does not appear to stimulate growth or increase growth hormone levels in the same way. Its actions are thought to be more limited to metabolic pathways.
Regulatory status varies. It is not approved for medical use in the United States or many other countries. It is banned in sport by WADA, and its sale as a supplement or research chemical may be subject to legal restrictions.
No. It is not approved as a therapeutic drug by major regulators. It is sold for research purposes in many settings, which is not the same as clinical approval.