If you have been reading about anti-doping and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-09-02. Numbers and descriptions here follow the published literature rather than marketing material.
AOD-9604 is a synthetic peptide that corresponds to a short section of human growth hormone. It is commonly identified as hGH fragment 176-191 because its sequence matches residues at the C-terminal end of the hormone. The molecule contains sixteen amino acids and is made by solid-phase peptide synthesis. Researchers study it for metabolic effects rather than for the growth-promoting actions associated with full human growth hormone. Its small size distinguishes it from the complete 191-amino-acid hormone.
Several names appear in scientific and commercial settings. AOD9604 and AOD-9604 are development codes used interchangeably, while hGH fragment 176-191 describes the same region. The peptide includes a disulfide bond between two cysteine residues, which helps shape its three-dimensional structure. Different suppliers may provide acetate or other salt forms, and purity can vary. These differences matter because analytical tests and biological assays can respond to the specific form being studied.
Regulatory bodies have taken different approaches to AOD-9604. It is not approved as a prescription medicine by major agencies such as the U.S. Food and Drug Administration or the European Medicines Agency. In sport, the World Anti-Doping Agency prohibits peptide hormones, growth factors, and related substances, and AOD-9604 has been treated as a prohibited substance. These regulatory decisions reflect concerns about safety, efficacy, and potential misuse rather than proof of benefit.
Research on AOD-9604 also examines how the peptide is measured in biological samples. Analytical methods may include liquid chromatography coupled with mass spectrometry, immunoassays, or both. Detection can be challenging because the peptide is small and may be present at low concentrations. Published methods vary in sensitivity and specificity, so comparative interpretation requires attention to validation details. The presence of related hGH fragments can complicate identification in some matrices.
AOD-9604 has been investigated mainly in the context of body fat and metabolic endpoints. Some early animal and small human studies reported changes in fat mass or lipid markers, but findings were not uniform. Larger, well-controlled trials that would establish efficacy are lacking in the public literature. As a result, claims about weight loss or metabolic benefit remain investigational rather than established. The distinction between a research finding and a proven clinical outcome is central to discussing this peptide.
| Property | Value | Notes |
|---|---|---|
| Common name | AOD-9604 | Development code used in scientific literature. |
| Chemical class | Synthetic peptide | Fragment of human growth hormone. |
| Amino acid length | 16 residues | Matches hGH region 176-191. |
| Appearance | White to off-white powder | Typical lyophilized peptide solid. |
| Solubility | Soluble in water | Dissolves in aqueous media; exact behavior depends on salt form. |
Regulatory status: AOD-9604 is not approved as a therapeutic drug in the United States, European Union, or other major markets. It is listed by the World Anti-Doping Agency as a prohibited substance in sport, specifically under growth hormone fragments. Many jurisdictions restrict its sale for human consumption. Products marketed online may not meet pharmaceutical quality standards. The legal status varies by country and often depends on whether the material is presented as a research chemical, supplement, or drug.
Detection and characterization of AOD-9604 in research and anti-doping settings typically rely on mass spectrometry coupled with liquid chromatography. These methods can identify the peptide by its mass and fragmentation pattern. Immunoassays may also be used in some screening contexts, but they can cross-react with related peptides. Because the molecule is small and may be present at low concentrations, sample preparation and method validation are important. Confirmatory analysis usually requires comparison with a certified reference standard.
In laboratory settings, AOD-9604 is commonly supplied as a lyophilized powder and stored cold to limit degradation. Reconstituted solutions are typically kept refrigerated or frozen, depending on the buffer and concentration, and protected from repeated freeze-thaw cycles. Stability can be influenced by pH, temperature, and the presence of proteases. Purity is usually assessed by high-performance liquid chromatography and mass spectrometry. These practices support reproducibility, but they do not imply safety or efficacy for any human use.
Development of AOD-9604 began in the 1990s as scientists sought to isolate metabolic effects of growth hormone without its growth-promoting actions. Early laboratory work focused on fat cells and animal models. Several human trials followed, examining changes in body composition and fat mass. Results have been mixed, and the peptide has not progressed to widespread clinical approval. Interest continues in research settings, particularly regarding its mechanism and potential metabolic targets.
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.
Clinical development of AOD9604 included trials in people with obesity, but the results did not lead to approval as a prescription medicine in major markets. Interest later shifted to research settings and to unapproved products marketed for body composition. Regulatory agencies have questioned whether the peptide qualifies as a dietary ingredient, and some have issued warnings about its presence in supplements. Long-term human safety data are limited, and questions about efficacy, dosing, and target populations remain unresolved.
AOD9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to a short sequence near the end of the 191-amino-acid hormone, often described as residues 176–191 or a related fragment. Researchers designed it to separate metabolic effects from the growth-promoting actions of full-length growth hormone. Early work in the 1990s explored it as a candidate for weight and lipid disorders. It is not a naturally circulating hormone fragment produced in large amounts.
Laboratory studies have reported that AOD9604 can increase lipolysis and reduce lipid accumulation in fat cells. The precise molecular target remains uncertain, and the compound does not appear to activate the growth hormone receptor in the same way as full-length hGH. Proposed mechanisms include effects on beta-adrenergic signaling and enzymes involved in fatty acid synthesis, but these pathways are not firmly established. Because most evidence comes from cell and animal models, whether the same effects occur in humans is an open question.
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
=== Microbiological uses === Quantitative PCR is also used by microbiologists working in the fields of food safety, food spoilage and fermentation and for the microbial risk assessment of water quality (drinking and recreational waters) and in public health protection. qPCR may also be used to amplify taxonomic or functional markers of genes in DNA taken from environmental samples. Markers are represented by genetic fragments of DNA or complementary DNA. By amplifying a certain genetic element, one can quantify the amount of the element in the sample prior to amplification. Using taxonomic markers (ribosomal genes) and qPCR can help determine the amount of microorganisms in a sample, and can identify different families, genera, or species based on the specificity of the marker. Using functional markers (protein-coding genes) can show gene expression within a community, which may reveal information about the environment.
Recently, the boundaries between various specialties have blurred, as they are all influenced by basic research in neuroscience. For example, brain imaging enables objective biological insight into mental illnesses, which can lead to faster diagnosis, more accurate prognosis, and improved monitoring of patient progress over time. Integrative neuroscience describes the effort to combine models and information from multiple levels of research to develop a coherent model of the nervous system. For example, brain imaging coupled with physiological numerical models and theories of fundamental mechanisms may shed light on psychiatric disorders. Another important area of translational research is brain–computer interfaces (BCIs), or machines that are able to communicate and influence the brain. They are currently being researched for their potential to repair neural systems and restore certain cognitive functions. Translational BCI research is supported by specialized neurotechnology platforms that enable high-resolution neural signal acquisition, real-time processing, and experimental validation in clinical and laboratory settings. Such platforms are developed by academic groups as well as industry partners, including systems produced by g.tec medical engineering GmbH.
1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC, EDAC or EDCI) is a water-soluble carbodiimide usually handled as the hydrochloride, which is a white solid. It is typically employed in the 4.0-6.0 pH range. It is generally used as a carboxyl activating agent for the coupling of primary amines to yield amide bonds. While other carbodiimides like dicyclohexylcarbodiimide (DCC) or diisopropylcarbodiimide (DIC) are also employed for this purpose, EDC has the advantage that the urea byproduct formed (often challenging to remove in the case of DCC or DIC) can be washed away from the amide product using dilute acid. Additionally, EDC can also be used to activate phosphate groups in order to form phosphomonoesters and phosphodiesters. Common uses for this carbodiimide include peptide synthesis, protein crosslinking to nucleic acids, but also in the preparation of immunoconjugates. EDC is often used in combination with N-hydroxysuccinimide (NHS) for the immobilisation of large biomolecules. Recent work has also used EDC to assess the structure state of uracil nucleobases in RNA.
Mycofactocin is thought to play a role in redox pathways involving nicotinoproteins, enzymes with non-exchangeable bound nicotinamide adenine dinucleotide (NAD). This notion comes largely from comparative genomics work that highlighted the many parallels between mycofactocin and pyrroloquinoline quinone (PQQ). In both cases, maturation of the RiPP requires post-translational modification of a precursor peptide by a radical SAM enzyme, the system appears in very similar form in large numbers of species, the product appears to be used within the cell rather than exported, and several families of enzymes occur exclusively in bacteria with those systems. The number of putatively mycofactocin-dependent oxidoreductases encoded by a single genome can be quite large: at least 19 for Rhodococcus jostii RHA1, and 26 for the short chain dehydrogenase/reductase (SDR) family alone in Mycobacterium avium. The enzyme LimC (Q9RA05), a nicotinoprotein carveol dehydrogenase (EC 1.1.1.n4), is shown to use both MFT and PMFT in vitro.
Sources: en.wikipedia.org
As a result, the more interesting possibilities remain on the table and the mystery of the tension deepens." Research suggests that replacing half of the beef, chicken, dairy and pork products consumed globally with plant-based alternatives by 2050 could reduce the amount of land used by agriculture by almost a third, bring deforestation for agriculture nearly to a halt, help restore biodiversity through rewilding the land and reduce GHG emissions from agriculture by 31%, paving a clearer path to reaching climate and biodiversity targets. A separate study (6 Sep) using a global food system model suggests that net-negative greenhouse gas emissions could be possible in a sustainable food system achievable with full global deployment of diverse interventions, with the most promising options including hydrogen-powered fertilizer production, livestock feeds, organic and inorganic soil amendments, agroforestry, sustainable seafood harvesting practices, and adoption of flexitarian diets. 18 September A new palm oil substitute called PALM-ALT is presented by researchers. The plant-based ingredient is shown to be 70% better for the environment than conventional palm oil and is described as "the holy grail to replace it". The Linac Coherent Light Source at the SLAC National Accelerator Laboratory is upgraded to LCLS-II and successfully demonstrates its first X-rays, which are fired 8,000 times faster and are 10,000 times brighter than the previous version.
Computational techniques are used to analyse high-throughput, low-measurement single cell data, such as that obtained from flow cytometry. These methods typically involve finding populations of cells that are relevant to a particular disease state or experimental condition.
In contrast, the border with Canada is primarily maintained through joint border patrol and security camera programs, making it the world's longest undefended border. In remote areas along the border with Canada, where staffed border crossings are unavailable, there are hidden sensors on roads, trails, railways, and wooded areas near crossing points. Members of the Schengen Agreement are required to apply strict checks on travellers entering and exiting the area. These checks are coordinated by the European Union's Frontex agency, and subject to common rules. The details of border controls, surveillance and the conditions under which permission to enter into the Schengen Area may be granted are exhaustively detailed in the Schengen Borders Code. All persons crossing external borders are subject to a check by a border guard. The only exception is for regular cross-border commuters (both those with the right of free movement and third-country nationals) who are well known to the border guards: once an initial check has shown that there is no alert on record relating to them in the Schengen Information System or national databases, they can only be subject to occasional 'random' checks, rather than systematic checks every time they cross the border. Additionally, border security in Europe is increasingly being outsourced to private companies, with the border security market growing at a rate of 7% per year.
Sources: en.wikipedia.org
=== Event appearances === Pert was honored by the New York Open Center on November 7, 2006, for her "leadership across the bridge between science and heart." Pert received the first time award of the Theophrastus Paracelsus Foundation in Holistic Medicine for her pioneering work in the area of psychoneuroimmunology (St Gallen, Switzerland) on April 12, 2008.
The musculoskeletal system consists of the human skeleton (which includes bones, ligaments, tendons, joints and cartilage) and attached muscles. It gives the body basic structure and the ability for movement. In addition to their structural role, the larger bones in the body contain bone marrow, the site of production of blood cells. Also, all bones are major storage sites for calcium and phosphate. This system can be split up into the muscular system and the skeletal system.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
Professors Mathematics or science: Arago, Berzelius, Biot, Curie, Frankenheim, Lehmann, Liebig, Mitscherlich, Ostwald, Pasteur, Reinitzer, Wöhler Mineralogy: Delafosse, Groth, Haüy, Neumann, Other employment: Brewster (editor), Romé de l'Isle (cataloguer), Sohncke (meteorological service), Wollaston (physician) Independently wealthy: Barlow, Herschel, Huygens In the nineteenth century there were informal schools of crystallography researchers in France (Arago, Biot, Curie, Delafosse, Haüy, Pasteur), Germany (Frankenheim, Groth, Lehmann, Liebig, Mitscherlich, Neumann, Reinitzer, Sohncke, Wöhler) and England (Barlow, Brewster, Herschel, Wollaston). Until the founding of Zeitschrift für Krystallographie und Mineralogie by Paul Groth in 1877 there was no lead journal for the publication of crystallographic papers. The majority of crystallographic research was published in the journals of national scientific societies, or in mineralogical journals. The inauguration of Groth's journal marked the emergence of crystallography as a mature science independent of geology.
Sources: en.wikipedia.org
AOD-9604 is a synthetic peptide fragment of human growth hormone. It corresponds to the C-terminal region known as hGH 176-191 and is studied for metabolic effects. It is not an approved therapeutic drug.
No. It contains only a small portion of the human growth hormone sequence. The full hormone has 191 amino acids and many additional actions that the fragment does not share.
The name refers to the amino acid positions in the human growth hormone chain. The fragment spans residues 176 through 191 at the C-terminal end. This naming convention helps distinguish it from full-length hGH.
No. It is not approved as a therapeutic drug by major regulators. It is sold for research purposes in many settings, which is not the same as clinical approval.